PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc034048.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 231aa    MW: 26945.7 Da    PI: 6.9237
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc034048.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.87e-43201415128
                      NAM   5 frFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                              +rF P+deel++ yL kkv++++l+  + i+ev++yk+ Pw+L +++++ +ek +yfF++  +ky++g+r+nra+ sg+Wkatg d
  Itr_sc034048.1_g00001.1  20 VRFCPSDEELIHSYLWKKVQNQPLPP-NKIHEVNLYKFSPWELSEMFETiGEKYCYFFTN--RKYKNGQRSNRAAGSGFWKATGAD 102
                              7**********************999.77**************96554436667788876..57889******************* PP

                      NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              k++++k++ lvg +k Lvfy+g+ pkg+kt+W+m eyr+
  Itr_sc034048.1_g00001.1 103 KSIMNKQKVLVGSRKALVFYEGKPPKGVKTNWIMYEYRV 141
                              *************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100546.36916163IPR003441NAC domain
SuperFamilySSF1019412.35E-5018163IPR003441NAC domain
PfamPF023655.1E-2120141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MEEFLVPDPT FVHDENTIVV RFCPSDEELI HSYLWKKVQN QPLPPNKIHE VNLYKFSPWE  60
LSEMFETIGE KYCYFFTNRK YKNGQRSNRA AGSGFWKATG ADKSIMNKQK VLVGSRKALV  120
FYEGKPPKGV KTNWIMYEYR VEGAPSPRPR GDDDWVLCRI YNKTDKSPEK KAAPKLSFLS  180
EQDEMDEMPA FYYLPMNEMP ASSDTKLKQL DCTYYIYAHN VITNEFQAAD L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-432116620171Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015055089.18e-57PREDICTED: NAC domain-containing protein 67-like
SwissprotA0SPJ81e-48NAM1_HORVD; NAC transcription factor NAM-1
TrEMBLK4D9G42e-55K4D9G4_SOLLC; Uncharacterized protein
STRINGSolyc11g065540.1.15e-55(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63790.14e-47NAC domain containing protein 102